Anti-BRD7 antibody (AAS18390C)

Print Page
  • (Catalog#: AAS18390C)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
BRD7 is an activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. It induces dephosphorylation of GSK3B at 'Tyr-216'.
Gene Symbol:
BRD7
Official Gene Full Name:
Bromodomain containing 7
Alias Symbols:
BP75; CELTIX1; NAG4
Protein Accession# :
NP_037395
Nucleotide Accession#:
NM_013263
Swissprot Id:
Q9NPI1
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
651
Molecular Weight:
74kDa
Application:
WB
Partner Proteins:
HIST1H2AE, HIST1H2BB, HIST1H3A, HIST2H4A, DNMT1, HDAC1
Immunogen:
Synthetic peptide corresponding to amino acids 587-647 of Human BRD7 protein, Q9NPI1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Guinea pig; Dog
Species Reactivity:
Dog, Guinea pig, Horse, Human, Pig, Rabbit
Datasheets / Downloads:
AAS18390C
Peptide Sequence:
EQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAEC
Blocking Peptide:
Peptide #: EAS18390
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: BRD7 antibody tested with Human Jurkat Cells (AAS18390C)

Antibody Verify is the original manufacturer of this BRD7 antibody (AAS18390C)

Click here to view the BRD7 antibody Western Blot Protocol

Product Datasheet Link: BRD7 antibody (AAS18390C)

WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: BRD7 is an activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. It induces dephosphorylation of GSK3B at 'Tyr-216'.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s BRD7 antibody (AAS18390C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Protocols & Procedures

back to top
Protocol:
Tips Information: