Anti-NR1H2 antibody (AAS06389E)

Print Page
  • (Catalog#: AAS06389E)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995).[supplied by OMIM].
Gene Symbol:
NR1H2
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 2
Alias Symbols:
LXR-b; LXRB; NER; NER-I; RIP15; UNR
Protein Accession# :
NP_009052
Nucleotide Accession#:
NM_007121
Swissprot Id:
Q68CY8
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
460
Molecular Weight:
51kDa
Application:
WB
Immunogen:
Synthetic peptide corresponding to amino acids 17-77 of Human NR1H2 protein, Q68CY8
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Guinea pig
Species Reactivity:
Dog, Guinea pig, Horse, Human
Datasheets / Downloads:
AAS06389E
Peptide Sequence:
GPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKG
Blocking Peptide:
Peptide #: EAS06389
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: