Anti-SUV420H1 antibody (AAS67345C)

Print Page
  • (Catalog#: AAS67345C)
100ul
$125.00
Discontinued

Target and Product Information

back to top
Description of Target:
SUV420H1 is a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined.
Gene Symbol:
SUV420H1
Official Gene Full Name:
Suppressor of variegation 4-20 homolog 1 (Drosophila)
Alias Symbols:
CGI-85; CGI85; KMT5B; MGC118906; MGC118909; MGC21161; MGC703
Swissprot Id:
Q4FZB7
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
885
Molecular Weight:
99kDa
Application:
WB
Partner Proteins:
YWHAQ
Immunogen:
Synthetic peptide corresponding to amino acids 766-826 of Human SUV420H1 protein, Q4FZB7
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Horse; Rat; Chicken
Species Reactivity:
Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat
Datasheets / Downloads:
AAS67345C
Peptide Sequence:
FNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEES
Blocking Peptide:
Peptide #: EAS67345
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: