Anti-TP53 antibody (AAS12303C)

Print Page
  • (Catalog#: AAS12303C)
100ul
$125.00
In Stock

Target and Product Information

back to top
Description of Target:
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Gene Symbol:
TP53
Alias Symbols:
LFS1; TRP53; p53
Protein Accession# :
NP_000537
Nucleotide Accession#:
NM_000546
Swissprot Id:
P04637
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
393
Molecular Weight:
44kDa
Application:
WB, CHIP
Partner Proteins:
AKT1, CARD11, PKN2, PRKCD, PRKCQ, PRKCZ, AKT1, AKT2, AKT3, AKTIP, CARD11, CDAN1, HSP90AA1, ILK, IRS1, ITGB3, MTOR, PAK1, PDPK1, PKN1, PKN2, PRKACA, PRKCB, PRKCD, PRKCE, PRKCI, PRKCZ, PRSS23, PTK2B, PXN, RALGDS, RPS6KA1, RPS6KA3, RPS6KB1, RPS6KB2, SGK1, SGK2, SGK3, SLC9A3R2, SRC, STRAP, YWHAH, YWH
Immunogen:
Synthetic peptide corresponding to amino acids 36-96 of Human TP53 protein, P04637
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human
Species Reactivity:
Human
Datasheets / Downloads:
AAS12303C
Peptide Sequence:
PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSS
Blocking Peptide:
Peptide #: EAS12303
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: TP53 antibody tested with Human 293T Cells (AAS12303C)

Antibody Verify is the original manufacturer of this TP53 antibody (AAS12303C)

Click here to view the TP53 antibody Western Blot Protocol

Product Datasheet Link: TP53 antibody (AAS12303C)

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T

Western Blot image:


Description of Target: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s TP53 antibody (AAS12303C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Protocols & Procedures

back to top
Protocol:
Tips Information: