Anti-CBX4 antibody (AAS02300C)

Print Page
  • (Catalog#: AAS02300C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Gene Symbol:
CBX4
Official Gene Full Name:
Chromobox homolog 4
Alias Symbols:
PC2; NBP16
Protein Accession# :
NP_003646
Nucleotide Accession#:
NM_003655
Swissprot Id:
O00257-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
560
Molecular Weight:
61kDa
Application:
WB, IHC
Partner Proteins:
ACTA1
Immunogen:
Synthetic peptide corresponding to amino acids 85-145 of Human CBX4 protein, O00257-2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Bovine; Dog; Guinea pig; Human; Mouse; Pig; Rabbit; Chicken; African clawed frog
Species Reactivity:
Bovine, Dog, Guinea pig, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS02300C
Peptide Sequence:
TFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHQYQPHSKERAGKPPPP
Blocking Peptide:
Peptide #: EAS02300
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(2)

back to top

Product Protocols: CBX4 antibody tested with Human Jurkat Cells (AAS02300C)

Antibody Verify is the original manufacturer of this CBX4 antibody (AAS02300C)

Click here to view the CBX4 antibody Western Blot Protocol

Product Datasheet Link: CBX4 antibody (AAS02300C)

WB Suggested Anti-CBX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:


Description of Target: The polycomb group (PcG protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s CBX4 antibody (AAS02300C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: CBX4 Antibody tested by IHC with human kidney (AAS02300C)

Antibody Verify is the original manufacturer of this CBX4 antibody.
Click here to view the CBX4 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: CBX4 antibody (AAS02300C)
IHC Information:
Rabbit Anti-CBX 4 Antibody
Catalog Number: AAS02300C
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: