Anti-CTNNB1 antibody (AAS01140E)

Print Page
  • (Catalog#: AAS01140E)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.
Gene Symbol:
CTNNB1
Official Gene Full Name:
Catenin (cadherin-associated protein), beta 1, 88kDa
Alias Symbols:
CTNNB
Protein Accession# :
XP_001133664
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
694
Molecular Weight:
76kDa
Application:
WB, IHC
Partner Proteins:
TRADD, DST, KRT5, PKP1, TCHP, TRADD, PKP1
Immunogen:
Synthetic peptide corresponding to amino acids 722-782 of Human CTNNB1 protein.
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
African clawed frog; Chicken; Dog; Guinea pig; Horse; Human; Mouse; Pig; Rabbit; Zebrafish
Datasheets / Downloads:
AAS01140E
Peptide Sequence:
GGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Blocking Peptide:
Peptide #: EAS38302
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: