Anti-GJB1 antibody (AAS00366E)

Print Page
  • (Catalog#: AAS00366E)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.
Gene Symbol:
GJB1
Official Gene Full Name:
Gap junction protein, beta 1, 32kDa
Alias Symbols:
CMTX; CX32; CMTX1
Protein Accession# :
NP_000157
Nucleotide Accession#:
NM_000166
Swissprot Id:
P08034
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
283
Molecular Weight:
31kDa
Application:
WB, IHC
Immunogen:
Synthetic peptide corresponding to amino acids 210-270 of Mouse GJB1 protein, P08034
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Dog; Guinea pig; Mouse; Chicken
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00366E
Peptide Sequence:
VYLIIRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGT
Blocking Peptide:
Peptide #: EAS00366
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: