Anti-GPNMB antibody (AAS00445C)

Print Page
  • (Catalog#: AAS00445C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
GPNMB
Official Gene Full Name:
Glycoprotein (transmembrane) nmb
Alias Symbols:
HGFIN; NMB
Protein Accession# :
NP_002501
Nucleotide Accession#:
NM_002510
Swissprot Id:
Q14956
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
560
Molecular Weight:
60kDa
Application:
WB, IHC
Partner Proteins:
SMAD4
Immunogen:
Synthetic peptide corresponding to amino acids 104-164 of Human GPNMB protein, Q14956
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Guinea pig; Horse; Human; Mouse; Rat; Bovine; Pig; African clawed frog; Rabbit; Dog; Zebrafish
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00445C
Peptide Sequence:
RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFP
Blocking Peptide:
Peptide #: EAS00445
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: