Anti-HEXA antibody (AAS00611C)

Print Page
  • (Catalog#: AAS00611C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
This gene encodes the alpha subunit of the lysosomal enzyme beta-hexosaminidase that, together with the cofactor GM2 activator protein, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Beta-hexosaminidase is composed of two subunits, alpha and beta, which are encoded by separate genes. Both beta-hexosaminidase alpha and beta subunits are members of family 20 of glycosyl hydrolases. Mutations in the alpha or beta subunit genes lead to an accumulation of GM2 ganglioside in neurons and neurodegenerative disorders termed the GM2 gangliosidoses. Alpha subunit gene mutations lead to Tay-Sachs disease (GM2-gangliosidosis type I).
Gene Symbol:
HEXA
Official Gene Full Name:
Hexosaminidase A (alpha polypeptide)
Alias Symbols:
MGC99608; TSD
Protein Accession# :
NP_000511
Nucleotide Accession#:
NM_000520
Swissprot Id:
P06865
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
529
Molecular Weight:
48kDa
Application:
WB, IHC
Partner Proteins:
GM2A, GM2A, USP22
Immunogen:
Synthetic peptide corresponding to amino acids 437-497 of Human HEXA protein, P06865
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Mouse; Pig; Bovine; Horse; Rabbit; Rat; Sheep; Guinea pig; Dog
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Datasheets / Downloads:
AAS00611C
Peptide Sequence:
VEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFA
Blocking Peptide:
Peptide #: EAS00611
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: