Anti-IRF9 antibody (AAS00312C)

Print Page
  • (Catalog#: AAS00312C)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
IRF9 functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.
Gene Symbol:
IRF9
Official Gene Full Name:
interferon regulatory factor 9
Alias Symbols:
p48; IRF-9; ISGF3; ISGF3G;
Protein Accession# :
NP_006075
Nucleotide Accession#:
NM_006084
Swissprot Id:
Q00978
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
393
Molecular Weight:
44kDa
Application:
WB, IHC
Partner Proteins:
EP300, GTF2B, PAX3, POU3F2, SOX10, TBP, EP300, GTF2B, POU3F2, POU3F4, PQBP1, SOX10, SOX11, TBP, POU3F4, PQBP1
Immunogen:
Synthetic peptide corresponding to amino acids 31-91 of Human ISGF3G protein, Q00978
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Rat; Human; Mouse; Bovine; Pig; Gilthead sea bream; Green puffer; African clawed frog; Goldfish; Zebrafish;
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Datasheets / Downloads:
AAS00312C
Peptide Sequence:
DDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK
Blocking Peptide:
Peptide #: EAS00312
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: