Anti-IRX3 antibody (AAS01428C)

Print Page
  • (Catalog#: AAS01428C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
IRX3 is a member of the Iroquois homeobox gene family that encodes a protein known for its essential role in spinal cord development.
Gene Symbol:
IRX3
Official Gene Full Name:
Iroquois homeobox 3
Alias Symbols:
IRX-1; IRXB1
Protein Accession# :
NP_077312
Nucleotide Accession#:
NM_024336
Swissprot Id:
P78415
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
501
Molecular Weight:
52kDa
Application:
WB, IHC
Immunogen:
Synthetic peptide corresponding to amino acids 378-438 of Human IRX3 protein, P78415
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Bovine; Dog; Pig; Horse; Mouse
Species Reactivity:
Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS01428C
Peptide Sequence:
VAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHLLG
Blocking Peptide:
Peptide #: EAS01428
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(2)

back to top

Product Protocols: IRX3 antibody tested with Human Hepg2 Cells (AAS01428C)

Antibody Verify is the original manufacturer of this IRX3 antibody (AAS01428C)

Click here to view the IRX3 antibody Western Blot Protocol

Product Datasheet Link: IRX3 antibody (AAS01428C)

WB Suggested Anti-IRX3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: IRX3 is a member of the Iroquois homeobox gene family that encodes a protein known for its essential role in spinal cord development.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s IRX3 antibody (AAS01428C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: IRX3 Antibody tested by IHC with human skin (AAS01428C)

Antibody Verify is the original manufacturer of this IRX3 antibody.
Click here to view the IRX3 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: IRX3 antibody (AAS01428C)
IHC Information:
Rabbit Anti-IRX3 Antibody
Catalog Number: AAS01428C
Paraffin Embedded Tissue: Human Skin
Cellular Data: Squamous epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: