Anti-IVNS1ABP antibody (AAS00331E)

Print Page
  • (Catalog#: AAS00331E)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
IVNS1ABP is a novel human protein that interacts with the influenza A virus. Nonstructural NS1 protein is relocalized in the nuclei of infected cells.
Gene Symbol:
IVNS1ABP
Official Gene Full Name:
Influenza virus NS1A binding protein
Alias Symbols:
ND1; NS-1; NS1BP; FLARA3; KLHL39; NS1-BP; HSPC068
Protein Accession# :
NP_006460
Nucleotide Accession#:
NM_006469
Swissprot Id:
Q9Y6Y0
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
642
Molecular Weight:
72kDa
Application:
WB, IHC
Partner Proteins:
ABL1, BCR, CRK, CRKL, GRB2, TANK, TRAF2, CRK, CRKL, TRAF2
Immunogen:
Synthetic peptide corresponding to amino acids 11-71 of Mouse IVNS1ABP protein, Q9Y6Y0
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Bovine; Dog; Guinea pig; Horse; Pig; Rabbit; Rat; Zebrafish
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00331E
Peptide Sequence:
DENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGI
Blocking Peptide:
Peptide #: EAS00331
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(2)

back to top

Product Protocols: IVNS1ABP antibody tested with Human Hepg2 Cells (AAS00331E)

Antibody Verify is the original manufacturer of this IVNS1ABP antibody (AAS00331E)

Click here to view the IVNS1ABP antibody Western Blot Protocol

Product Datasheet Link: IVNS1ABP antibody (AAS00331E)

WB Suggested Anti-IVNS1ABP Antibody Titration: 2.0ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: IVNS1ABP is a novel human protein that interacts with the influenza A virus. Nonstructural NS1 protein is relocalized in the nuclei of infected cells.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s IVNS1ABP antibody (AAS00331E) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: IVNS1ABP Antibody tested by IHC with human stomach (AAS00331E)

Antibody Verify is the original manufacturer of this IVNS1ABP antibody.
Click here to view the IVNS1ABP antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: IVNS1ABP antibody (AAS00331E)
IHC Information:
Rabbit Anti-IVNS1ABP Antibody
Catalog Number: AAS00331E
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of Fundic Gland
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: