Anti-MED16 antibody (AAS01323E)

Print Page
  • (Catalog#: AAS01323E)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
MED16 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.
Gene Symbol:
MED16
Official Gene Full Name:
mediator complex subunit 16
Alias Symbols:
DRIP92; THRAP5; TRAP95;
Protein Accession# :
NP_005472
Nucleotide Accession#:
NM_005481
Swissprot Id:
Q9Y2X0
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
877
Molecular Weight:
97kDa
Application:
WB, IHC
Immunogen:
Synthetic peptide corresponding to amino acids 726-786 of Human THRAP5 protein, Q9Y2X0
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Rat; Dog; Mouse;
Species Reactivity:
Bovine, Dog, Guinea pig, Human, Mouse, Pig, Rat
Datasheets / Downloads:
AAS01323E
Peptide Sequence:
IPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRL
Blocking Peptide:
Peptide #: EAS01323
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: