Anti-MGAT2 antibody (AAS01447E)

Print Page
  • (Catalog#: AAS01447E)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. Two transcript variants encoding the same protein have been identified for this gene.
Gene Symbol:
MGAT2
Official Gene Full Name:
Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
Alias Symbols:
CDGS2; GLCNACTII; GNT-II; GNT2; CDG2A
Protein Accession# :
NP_002399
Nucleotide Accession#:
NM_002408
Swissprot Id:
Q10469
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
447
Molecular Weight:
51kDa
Application:
WB, IHC
Immunogen:
Synthetic peptide corresponding to amino acids 188-248 of Human MGAT2 protein, Q10469
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
African clawed frog; Bovine; Horse; Human; Mouse; Pig; Rabbit; Rat; Zebrafish
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Datasheets / Downloads:
AAS01447E
Peptide Sequence:
FPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKI
Blocking Peptide:
Peptide #: EAS01447
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: