Anti-NAA16 antibody (AAS01489C)

Print Page
  • (Catalog#: AAS01489C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
NAA16 may belong to a complex displaying N-terminal acetyltransferase activity.
Gene Symbol:
NAA16
Official Gene Full Name:
N(alpha)-acetyltransferase 16, NatA auxiliary subunit
Alias Symbols:
NARG1L; RP11-396A22.1;
Protein Accession# :
NP_001104268
Nucleotide Accession#:
NM_001110798
Swissprot Id:
B0QZ59
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
429
Molecular Weight:
50kDa
Application:
WB, IHC
Partner Proteins:
SMURF1
Immunogen:
Synthetic peptide corresponding to amino acids 335-395 of Human NARG1L protein, B0QZ59
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Bovine; Mouse; Crab-eating macaque;
Species Reactivity:
Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS01489C
Peptide Sequence:
NTEKVSIIQELVTNYEASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLAL
Blocking Peptide:
Peptide #: EAS01489
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: NARG1L Antibody tested by IHC with human muscle (AAS01489C)

Antibody Verify is the original manufacturer of this NARG1L antibody.
Click here to view the NARG1L antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: NARG1L antibody (AAS01489C)
IHC Information:
Rabbit Anti-NARG1L Antibody
Catalog Number: AAS01489C
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: