Anti-NR2C2 antibody (AAS01480E)

Print Page
  • (Catalog#: AAS01480E)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes.Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes (Yoshikawa et al., 1996).[supplied by OMIM].
Gene Symbol:
NR2C2
Official Gene Full Name:
Nuclear receptor subfamily 2, group C, member 2
Alias Symbols:
TAK1; TR2R1; TR4; hTAK1
Protein Accession# :
NP_003289
Nucleotide Accession#:
NM_003298
Swissprot Id:
P49116
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
615
Molecular Weight:
67kDa
Application:
WB, IHC
Partner Proteins:
AR, COPS2, ESR1, ESR2, ESRRA, NR5A1, NRIP1, PPARG, RORA, SNW1, SREBF1, AR, COPS2, NR5A1, NRIP1, SREBF1
Immunogen:
Synthetic peptide corresponding to amino acids 444-504 of Human NR2C2 protein, P49116
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Bovine; Chicken; Dog; Horse; Human; Mouse; Pig; Rabbit; Rat; Guinea pig
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS01480E
Peptide Sequence:
ELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAK
Blocking Peptide:
Peptide #: EAS01480
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: NR2C2 Antibody tested by IHC with human skin (AAS01480E)

Antibody Verify is the original manufacturer of this NR2C2 antibody.
Click here to view the NR2C2 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: NR2C2 antibody (AAS01480E)
IHC Information:
Rabbit Anti-NR2C2 Antibody
Catalog Number: AAS01480E
Paraffin Embedded Tissue: Human Skin
Cellular Data: Squamous epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: