Anti-OAS1 antibody (AAS01404C)

Print Page
  • (Catalog#: AAS01404C)
100ul
$125.00
In Stock

Target and Product Information

back to top
Description of Target:
This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactio
Gene Symbol:
OAS1
Official Gene Full Name:
2'-5'-oligoadenylate synthetase 1, 40/46kDa
Alias Symbols:
IFI-4; OIAS; OIASI
Protein Accession# :
NP_002525
Nucleotide Accession#:
NM_024833
Swissprot Id:
P00973-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
364
Molecular Weight:
42kDa
Application:
WB, IHC
Partner Proteins:
ANAPC5, ATXN2, CARM1, CSDE1, EIF4B, EIF4G1, EIF4G3, GNB2L1, GSPT1, GSPT2, HNRNPD, NDRG1, PABPC1, PAIP1, PAIP2, PAIP2B, PAN2, PCBP1, PCBP2, PCSK7, PXN, SFRS12, STAU1, SYCP3, SYNCRIP, YWHAG, AIRE, ANAPC5, BCAR3, CNOT7, DYNLL1, EIF4A1, EIF4A2, EIF4B, EIF4G1, EIF4G3, ETF1, GNB2L1, GSPT1, GSPT2, HNR
Immunogen:
Synthetic peptide corresponding to amino acids 1-61 of Human OAS1 protein, P00973-2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Bovine; Horse; Mouse; Dog; Pig
Species Reactivity:
Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit
Datasheets / Downloads:
AAS01404C
Peptide Sequence:
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
Blocking Peptide:
Peptide #: EAS01404
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: OAS1 antibody tested with Human Fetal Stomach Tissue (AAS01404C)

Antibody Verify is the original manufacturer of this OAS1 antibody (AAS01404C)

Click here to view the OAS1 antibody Western Blot Protocol

Product Datasheet Link: OAS1 antibody (AAS01404C)

WB Suggested Anti-OAS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Stomach

Western Blot image:


Description of Target: This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactio

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s OAS1 antibody (AAS01404C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Protocols & Procedures

back to top
Protocol:
Tips Information: