Anti-OVOL1 antibody (AAS00385E)

Print Page
  • (Catalog#: AAS00385E)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
OVOL1 is a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.This gene encodes a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.
Gene Symbol:
OVOL1
Official Gene Full Name:
Ovo-like 1(Drosophila)
Alias Symbols:
HOVO1
Protein Accession# :
NP_004552
Nucleotide Accession#:
NM_004561
Swissprot Id:
O14753
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
267
Molecular Weight:
30kDa
Application:
WB, IHC
Partner Proteins:
ESR1, ESR1
Immunogen:
Synthetic peptide corresponding to amino acids 190-250 of Human OVOL1 protein, O14753
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Bovine; Dog; Goat; Guinea pig; Human; Rat; Mouse; Rabbit
Species Reactivity:
Bovine, Dog, Goat, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00385E
Peptide Sequence:
ESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKV
Blocking Peptide:
Peptide #: EAS00385
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Protocols & Procedures

back to top
Protocol:
Tips Information: