Anti-PA2G4 antibody (AAS01476C)

Print Page
  • (Catalog#: AAS01476C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
PA2G4
Official Gene Full Name:
Proliferation-associated 2G4, 38kDa
Alias Symbols:
EBP1; HG4-1; p38-2G4
Protein Accession# :
NP_006182
Nucleotide Accession#:
NM_006191
Swissprot Id:
Q9UQ80
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
394
Molecular Weight:
44kDa
Application:
WB, IHC
Partner Proteins:
ERBB3, HDAC2, AR, ERBB3, EXOSC5, HDAC2, PRKCA, PRKCB, PRKCG, RB1, SIN3A, SUMO4, AR, ATR, ERBB3, HDAC2, MTOR, RB1, SGK1, USP39
Immunogen:
Synthetic peptide corresponding to amino acids 329-389 of Human PA2G4 protein, Q9UQ80
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
African clawed frog; Bovine; Dog; Guinea pig; Horse; Human; Mouse; Pig; Rat; Zebrafish
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Datasheets / Downloads:
AAS01476C
Peptide Sequence:
GPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLE
Blocking Peptide:
Peptide #: EAS01476
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: PA2G4 antibody tested with Human Hepg2 Cells (AAS01476C)

Antibody Verify is the original manufacturer of this PA2G4 antibody (AAS01476C)

Click here to view the PA2G4 antibody Western Blot Protocol

Product Datasheet Link: PA2G4 antibody (AAS01476C)

WB Suggested Anti-PA2G4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s PA2G4 antibody (AAS01476C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Protocols & Procedures

back to top
Protocol:
Tips Information: