Anti-PON1 antibody (AAS00414C)

Print Page
  • (Catalog#: AAS00414C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low
Gene Symbol:
PON1
Official Gene Full Name:
Paraoxonase 1
Alias Symbols:
ESA; PON; MVCD5
Protein Accession# :
NP_000437
Nucleotide Accession#:
NM_000446
Swissprot Id:
P27169
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
355
Molecular Weight:
40kDa
Application:
WB, IHC
Partner Proteins:
ALB, APOA1, CLU
Immunogen:
Synthetic peptide corresponding to amino acids 208-268 of Human PON1 protein, P27169
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Pig; Rabbit; Dog; Mouse; Rat; Bovine
Species Reactivity:
Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00414C
Peptide Sequence:
YSPSEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTL
Blocking Peptide:
Peptide #: EAS00414
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: PON1 antibody tested with Human Ht1080 Cells (AAS00414C)

Antibody Verify is the original manufacturer of this PON1 antibody (AAS00414C)

Click here to view the PON1 antibody Western Blot Protocol

Product Datasheet Link: PON1 antibody (AAS00414C)

WB Suggested Anti-PON1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080

Western Blot image:


Description of Target: PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s PON1 antibody (AAS00414C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Protocols & Procedures

back to top
Protocol:
Tips Information: