Anti-PSEN1 antibody (AAS01442C)

Print Page
  • (Catalog#: AAS01442C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form o
Gene Symbol:
PSEN1
Official Gene Full Name:
Presenilin 1
Alias Symbols:
AD3; FAD; PS1; S182; PS-1
Protein Accession# :
NP_000012
Nucleotide Accession#:
NM_000021
Swissprot Id:
P49768
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
467
Molecular Weight:
53kDa
Application:
WB
Partner Proteins:
BCHE, COLQ, BCHE, COLQ
Immunogen:
Synthetic peptide corresponding to amino acids 84-144 of Human PSEN1 protein, P49768
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Guinea pig; Human; Mouse; Pig; Bovine; Zebrafish
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Datasheets / Downloads:
AAS01442C
Peptide Sequence:
MLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVI
Blocking Peptide:
Peptide #: EAS01442
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: PSEN1 antibody tested with Human Ovcar-3 Cells (AAS01442C)

Antibody Verify is the original manufacturer of this PSEN1 antibody (AAS01442C)

Click here to view the PSEN1 antibody Western Blot Protocol

Product Datasheet Link: PSEN1 antibody (AAS01442C)

WB Suggested Anti-PSEN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3

Western Blot image:


Description of Target: Alzheimer's disease (AD patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2 or in the amyloid precursor protein (APP. These disease-linked mutations result in increased production of the longer form o

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s PSEN1 antibody (AAS01442C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Protocols & Procedures

back to top
Protocol:
Tips Information: