Anti-RAE1 antibody (AAS01403C)

Print Page
  • (Catalog#: AAS01403C)
100ul
$125.00
In Stock

Target and Product Information

back to top
Description of Target:
RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Gene Symbol:
RAE1
Official Gene Full Name:
RAE1 RNA export 1 homolog (S. pombe)
Alias Symbols:
MIG14; MRNP41; Mnrp41; dJ481F12.3; dJ800J21.1
Protein Accession# :
NP_001015885
Nucleotide Accession#:
NM_001015885
Swissprot Id:
P78406
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
368
Molecular Weight:
40kDa
Application:
WB, IHC
Partner Proteins:
BUB1, DDX24, KLRC4, NUP98, NXF1, AGGF1, ARMC8, ATE1, BUB1, Bub1, COPS6, COPS8, CS, DDX19B, FAF1, FAM122B, HSP90B1, KLRK1, MAGED4B, MAP1B, MIOS, MPST, MYCBP2, NUP188, NUP214, NUP62, NUP88, NUP93, NUP98, NUPL2, POLA1, POLA2, POLR3A, POLR3B, POLR3E, POLR3H, PRIM1, PRIM2, PRKD2, PRKD3, RBM8A, SART1,
Immunogen:
Synthetic peptide corresponding to amino acids 304-364 of Human RAE1 protein, P78406
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
African clawed frog; Bovine; Chicken; Dog; Human; Mouse; Rabbit; Rat; Zebrafish
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Datasheets / Downloads:
AAS01403C
Peptide Sequence:
ARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELK
Blocking Peptide:
Peptide #: EAS01403
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(3)

back to top

Product Protocols: RAE1 antibody tested with Human Jurkat Cells (AAS01403C)

Antibody Verify is the original manufacturer of this RAE1 antibody (AAS01403C)

Click here to view the RAE1 antibody Western Blot Protocol

Product Datasheet Link: RAE1 antibody (AAS01403C)

WB Suggested Anti-RAE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:


Description of Target: RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s RAE1 antibody (AAS01403C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: RAE1 Antibody tested by IHC with human kidney (AAS01403C)

Antibody Verify is the original manufacturer of this RAE1 antibody.
Click here to view the RAE1 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RAE1 antibody (AAS01403C)
IHC Information:
Rabbit Anti-RAE1 Antibody
Catalog Number: AAS01403C
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Product Protocols: RAE1 Antibody tested by IHC with human skin (AAS01403C)

Antibody Verify is the original manufacturer of this RAE1 antibody.
Click here to view the RAE1 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RAE1 antibody (AAS01403C)
IHC Information:
Rabbit Anti-RAE1 Antibody
Catalog Number: AAS01403C
Paraffin Embedded Tissue: Human Skin
Antibody Concentration: 5 ug/ml
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: