Anti-RARB antibody (AAS01456C)

Print Page
  • (Catalog#: AAS01456C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined.
Gene Symbol:
RARB
Official Gene Full Name:
Retinoic acid receptor, beta
Alias Symbols:
HAP; NR1B2; RRB2
Protein Accession# :
NP_000956
Nucleotide Accession#:
NM_000965
Swissprot Id:
P10826
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
448
Molecular Weight:
50kDa
Application:
WB, IHC
Partner Proteins:
ARHGEF15, CALM1, DAXX, DUT, ESRRA, NCOA1, NR0B2, NRIP1, PNRC1, PNRC2, PPARGC1A, PPARGC1B, PROX1, ESRRG, HGS, NCOA1
Immunogen:
Synthetic peptide corresponding to amino acids 362-422 of Human RARB protein, P10826
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Dog; Horse; Human; Mouse; Pig; Chicken
Species Reactivity:
Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS01456C
Peptide Sequence:
SKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSS
Blocking Peptide:
Peptide #: EAS01456
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: RARB antibody tested with Human Fetal Brain Tissue (AAS01456C)

Antibody Verify is the original manufacturer of this RARB antibody (AAS01456C)

Click here to view the RARB antibody Western Blot Protocol

Product Datasheet Link: RARB antibody (AAS01456C)

WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Brain

Western Blot image:


Description of Target: RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s RARB antibody (AAS01456C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Protocols & Procedures

back to top
Protocol:
Tips Information: