Anti-RNF25 antibody (AAS00433C)

Print Page
  • (Catalog#: AAS00433C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.
Gene Symbol:
RNF25
Official Gene Full Name:
Ring finger protein 25
Alias Symbols:
AO7; FLJ13906
Protein Accession# :
NP_071898
Nucleotide Accession#:
NM_022453
Swissprot Id:
Q96BH1
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
459
Molecular Weight:
51kDa
Application:
WB, IHC
Immunogen:
Synthetic peptide corresponding to amino acids 198-258 of Human RNF25 protein, Q96BH1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Dog; Human; Mouse; Rat; Bovine; Horse; Pig
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00433C
Peptide Sequence:
CPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLEAE
Blocking Peptide:
Peptide #: EAS00433
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: RNf25 Antibody tested by IHC with human skin (AAS00433C)

Antibody Verify is the original manufacturer of this RNf25 antibody.
Click here to view the RNf25 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RNf25 antibody (AAS00433C)
IHC Information:
Rabbit Anti-RNf25 Antibody
Catalog Number: AAS00433C
Paraffin Embedded Tissue: Human Skin
Cellular Data: Squamous epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: