Anti-RPN2 antibody (AAS00454C)

Print Page
  • (Catalog#: AAS00454C)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum. The protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains.This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1.
Gene Symbol:
RPN2
Official Gene Full Name:
Ribophorin II
Alias Symbols:
RIBIIR; RPN-II; RPNII; SWP1
Protein Accession# :
NP_002942
Nucleotide Accession#:
NM_002951
Swissprot Id:
P04844
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
631
Molecular Weight:
67kDa
Application:
WB, IHC
Partner Proteins:
ADRM1, EZH2, NDRG1, BRE, EZH2, GSTK1, SAP18, TMBIM4
Immunogen:
Synthetic peptide corresponding to amino acids 153-213 of Human RPN2 protein, P04844
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Dog; Horse; Human; Mouse; Rabbit; Bovine; Pig; Rat
Species Reactivity:
Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00454C
Peptide Sequence:
SKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFV
Blocking Peptide:
Peptide #: EAS00454
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: RPN2 Antibody tested by IHC with human skin (AAS00454C)

Antibody Verify is the original manufacturer of this RPN2 antibody.
Click here to view the RPN2 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RPN2 antibody (AAS00454C)
IHC Information:
Rabbit Anti-RPN2 Antibody
Catalog Number: AAS00454C
Paraffin Embedded Tissue: Human Skin
Cellular Data: Squamous epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: