Anti-SQLE antibody (AAS01421C)

Print Page
  • (Catalog#: AAS01421C)
100ul
$125.00
Discontinued
Our latest data images

Target and Product Information

back to top
Description of Target:
Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.
Gene Symbol:
SQLE
Official Gene Full Name:
Squalene epoxidase
Alias Symbols:
FLJ30795
Protein Accession# :
BAA11209
Nucleotide Accession#:
NM_003129
Swissprot Id:
Q14534
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
349
Molecular Weight:
39kDa
Application:
WB, IHC
Partner Proteins:
OVGP1, PROL1, MUC5B
Immunogen:
Synthetic peptide corresponding to amino acids 445-505 of Human SQLE protein, Q14534
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Bovine; Human; Mouse; Sheep; Dog; Pig; Rat; Guinea pig; Horse; Chicken
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Datasheets / Downloads:
AAS01421C
Peptide Sequence:
AAIFEAKKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGECVAG
Blocking Peptide:
Peptide #: EAS01421
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: SQLE Antibody tested by IHC with human liver (AAS01421C)

Antibody Verify is the original manufacturer of this SQLE antibody.
Click here to view the SQLE antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: SQLE antibody (AAS01421C)
IHC Information:
Rabbit Anti-SQLE Antibody
Catalog Number: AAS01421C
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: