Anti-STAT5B antibody (AAS00390C)

Print Page
  • (Catalog#: AAS00390C)
100ul
$125.00
In Stock

Target and Product Information

back to top
Description of Target:
The protein is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
STAT5B
Official Gene Full Name:
Signal transducer and activator of transcription 5B
Alias Symbols:
STAT5
Protein Accession# :
NP_036580
Nucleotide Accession#:
NM_012448
Swissprot Id:
P51692
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
787
Molecular Weight:
90kDa
Application:
WB, IHC
Partner Proteins:
NMI, STAT5B, CBL, CD247, CENPJ, CRK, CRKL, CTLA4, CXCR4, EGFR, ELP2, EP300, EPOR, ERBB4, ETS1, ETS2, GHR, IL2RA, IL2RB, IL7R, INSR, JAK2, KIT, MAPK1, NCOR2, NMI, NR3C1, PDGFRA, PDGFRB, POU2F1, PPP2CA, PTPN1, PTPN11, PTPN2, PTPN6, RARA, SHC1, SRC, STAP2, STAT1, STAT3, STAT5A, STAT5B, TEK, CCR5, CD247
Immunogen:
Synthetic peptide corresponding to amino acids 27-87 of Human STAT5B protein, P51692
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Chicken; Dog; Horse; Human; Pig; Rabbit; Bovine; African clawed frog
Species Reactivity:
Bovine, Dog, Goat, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Datasheets / Downloads:
AAS00390C
Peptide Sequence:
PIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIK
Blocking Peptide:
Peptide #: EAS00390
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(1)

back to top

Product Protocols: STAT5B Antibody tested by IHC with human testis (AAS00390C)

Antibody Verify is the original manufacturer of this STAT5B antibody.
Click here to view the STAT5B antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: STAT5B antibody (AAS00390C)
IHC Information:
Rabbit Anti-STAT5B Antibody
Catalog Number: AAS00390C
Paraffin Embedded Tissue: Human Testis
Antibody Concentration: 5 ug/ml
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: