Anti-STK3 antibody (AAS01487E)

Print Page
  • (Catalog#: AAS01487E)
100ul
$125.00
In Stock

Target and Product Information

back to top
Description of Target:
Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand (MIM 134638) (Taylor et al., 1996 [PubMed 8816758]; Lee et al., 2001 [PubMed 11278283]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-11 U26424.1 1-11 12-2826 BC010640.2 1-2815
Gene Symbol:
STK3
Official Gene Full Name:
Serine/threonine kinase 3
Alias Symbols:
FLJ90748; KRS1; MST2
Protein Accession# :
NP_006272
Nucleotide Accession#:
NM_006281
Swissprot Id:
Q13188
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
491
Molecular Weight:
56kDa
Application:
WB, IHC
Partner Proteins:
BDP1, BRF1, C14orf1, C1orf103, GTF3C4, KAT5, PRPF4B, STC2, WDR89, C14orf1, C1orf103, GTF3C4, KAT5, POLR3C, POLR3D, PRPF4B, STC2, TBP, WDR89
Immunogen:
Synthetic peptide corresponding to amino acids 338-398 of Human STK3 protein, Q13188
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Bovine; Dog; Guinea pig; Horse; Human; Mouse; Pig; Rabbit; Rat; African clawed frog; Zebrafish
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS01487E
Peptide Sequence:
RATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYF
Blocking Peptide:
Peptide #: EAS01487
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(4)

back to top

Product Protocols: STK3 antibody tested with Human Hepg2 Cells (AAS01487E)

Antibody Verify is the original manufacturer of this STK3 antibody (AAS01487E)

Click here to view the STK3 antibody Western Blot Protocol

Product Datasheet Link: STK3 antibody (AAS01487E)

WB Suggested Anti-STK3 Antibody Titration: 5.0ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20 kinase acts upstream of the mitogen-activated protein kinase (MAPK cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20 kinase acts upstream of the mitogen-activated protein kinase (MAPK cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand (MIM 134638 (Taylor et al., 1996 [PubMed 8816758]; Lee et al., 2001 [PubMed 11278283].[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-11 U26424.1 1-11 12-2826 BC010640.2 1-2815

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s STK3 antibody (AAS01487E) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: STK3 Antibody tested by IHC with human kidney (AAS01487E)

Antibody Verify is the original manufacturer of this STK3 antibody.
Click here to view the STK3 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: STK3 antibody (AAS01487E)
IHC Information:
Rabbit Anti-STK3 Antibody
Catalog Number: AAS01487E
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Product Review: STK3 Antibody (AAS01487E) in RPE-1 (Human retinal pigment epithelial cell line) cells using Western Blot

Product Page for STK3 antibody-C-terminal region (AAS01487E_T100)
Application: Western blotting
Species+tissue/cell type: RPE-1 (Human retinal pigment epithelial cell line) cells
How many ug’s of tissue/cell lysate run on the gel:
1: 100ug uninduced RPE-1 lysate
2: 100ug uninduced RPE-1 lysate
3: 100ug STK3 induced RPE-1 lysate
4: 100ug STK3 induced RPE-1 lysate
Primary antibody dilution: 1:2000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:5000
 width='300' height='263' /></a></p></div>
							</div>
												<div class=

Product Review: STK3 Antibody (AAS01487E) in COS-7 cells (Monkey Kidney Fibroblast cell line) using Western Blot

Product Page for STK3 antibody-C-terminal region (AAS01487E)
Application: Western blotting
Species+tissue/cell type: COS-7 cells (Monkey Kidney Fibroblast cell line)
How many ug’s of tissue/cell lysate run on the gel:
1: 100ug untransfected COS-7 lysate
2: 100ug mock transfected Cos-7 lysate
3: 100ug STK3 transfected Cos-7 lysate
4: 50 ug STK3 transfected Cos-7 lysate
5: 25 ug STK3 transfected Cos-7 lysate
Primary antibody dilution: 1:2000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:5000

Protocols & Procedures

back to top
Protocol:
Tips Information: