Anti-TAF1A antibody (AAS02008C)

Print Page
  • (Catalog#: AAS02008C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.
Gene Symbol:
TAF1A
Official Gene Full Name:
TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
Alias Symbols:
SL1; RAFI48; TAFI48; MGC:17061
Protein Accession# :
NP_647603
Nucleotide Accession#:
NM_139352
Swissprot Id:
Q9NWA1
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
336
Molecular Weight:
40kDa
Application:
WB
Partner Proteins:
ETV6, FLI1, HDAC9, KAT5, L3MBTL, SIN3A, SMURF1, SUMO1, UBE2I, ACTA1, CRKL, ETV6, FBXL6, FLI1, GAB2, GRB2, HDAC9, IRF8, KAT5, L3MBTL, SKP1, UBC
Immunogen:
Synthetic peptide corresponding to amino acids 387-447 of Human TAF1A protein, Q9NWA1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Dog; Horse; Mouse; Pig; Rabbit; Rat; Bovine
Datasheets / Downloads:
AAS02008C
Peptide Sequence:
FWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIV
Blocking Peptide:
Peptide #: EAS44311
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(2)

back to top

Product Protocols: TAF1A antibody tested with Human Jurkat Cells (AAS02008C)

Antibody Verify is the original manufacturer of this TAF1A antibody (AAS02008C)

Click here to view the TAF1A antibody Western Blot Protocol

Product Datasheet Link: TAF1A antibody (AAS02008C)

WB Suggested Anti-TAF1A Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP and three TBP-associated factors (TAFs specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s TAF1A antibody (AAS02008C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: TAF1A Antibody tested by IHC with human heart (AAS02008C)

Antibody Verify is the original manufacturer of this TAF1A antibody.
Click here to view the TAF1A antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: TAF1A antibody (AAS02008C)
IHC Information:
Rabbit Anti-TAF1A Antibody
Catalog Number: AAS02008C
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: