Anti-TCFL5 antibody (AAS00315C)

Print Page
  • (Catalog#: AAS00315C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.
Gene Symbol:
TCFL5
Official Gene Full Name:
Transcription factor-like 5 (basic helix-loop-helix)
Alias Symbols:
CHA; Figlb; E2BP-1; bHLHe82
Protein Accession# :
NP_006593
Nucleotide Accession#:
NM_006602
Swissprot Id:
Q9UL49
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
500
Molecular Weight:
53kDa
Application:
WB, IHC
Partner Proteins:
NGFR
Immunogen:
Synthetic peptide corresponding to amino acids 213-273 of Human TCFL5 protein, Q9UL49
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Mouse; Bovine; Dog; Guinea pig; Horse
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat
Datasheets / Downloads:
AAS00315C
Peptide Sequence:
ALNNLVTLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTSGNSN
Blocking Peptide:
Peptide #: EAS00315
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(2)

back to top

Product Protocols: TCFL5 antibody tested with Human Hepg2 Cells (AAS00315C)

Antibody Verify is the original manufacturer of this TCFL5 antibody (AAS00315C)

Click here to view the TCFL5 antibody Western Blot Protocol

Product Datasheet Link: TCFL5 antibody (AAS00315C)

WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s TCFL5 antibody (AAS00315C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: TCFL5 Antibody tested by IHC with human kidney (AAS00315C)

Antibody Verify is the original manufacturer of this TCFL5 antibody.
Click here to view the TCFL5 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: TCFL5 antibody (AAS00315C)
IHC Information:
Rabbit Anti-TCFL5 Antibody
Catalog Number: AAS00315C
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: