Anti-TMEM8B antibody (AAS00419C)

Print Page
  • (Catalog#: AAS00419C)
100ul
$125.00
In Stock
Our latest data images

Target and Product Information

back to top
Description of Target:
The down-regulation of TMEM8B may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.
Gene Symbol:
TMEM8B
Official Gene Full Name:
transmembrane protein 8B
Alias Symbols:
NGX6; NAG-5; C9orf127; RP11-112J3.10;
Protein Accession# :
NP_057530
Nucleotide Accession#:
NM_016446
Swissprot Id:
Q9HBY2
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
338
Molecular Weight:
37kDa
Application:
WB, IHC
Partner Proteins:
EZR
Immunogen:
Synthetic peptide corresponding to amino acids 4-64 of Human C9orf127 protein, Q9HBY2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml.
Predicted Homology:
Human; Bovine; Mouse; Rat;
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
AAS00419C
Peptide Sequence:
PQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVAL
Blocking Peptide:
Peptide #: EAS00419
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Antibody Reviews and Data(2)

back to top

Product Protocols: C9orf127 antibody tested with Human Hepg2 Cells (AAS00419C)

Antibody Verify is the original manufacturer of this C9orf127 antibody (AAS00419C)

Click here to view the C9orf127 antibody Western Blot Protocol

Product Datasheet Link: C9orf127 antibody (AAS00419C)

WB Suggested Anti-C9orf127 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.

Questions pertaining to this data can be directed to techsupport@antibodyverify.com

Antibody Verify’s C9orf127 antibody (AAS00419C) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@antibodyverify.com.

To order by phone call us at (800) 963-3931, fax us at (702) 425-5639 or send an email to info@antibodyverify.com. Antibody Verify manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Antibody Verify’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@antibodyverify.com

Product Protocols: C9orf127 Antibody tested by IHC with human kidney (AAS00419C)

Antibody Verify is the original manufacturer of this C9orf127 antibody.
Click here to view the C9orf127 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: C9orf127 antibody (AAS00419C)
IHC Information:
Rabbit Anti-C9orf127 Antibody
Catalog Number: AAS00419C
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:

Protocols & Procedures

back to top
Protocol:
Tips Information: